McDonnell Genome Institute

Washington University

CircRNA

chr11|103311877|103358359|+|DYNC2H1|ENST00000375735.6

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9499

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

LNQSPPGLK

Amino Acids from 5' Exons

SPPGLKKNLMRTYESWTPEQISKKDNTHRAHALFSLAWFHAACQERRNYIPQ,HLQVRRICVLMSLGLLSKLAKKIIHIELMLSSVLHGFMLHVKKEETIFL,TSRFKEEFNAYLVLDSANQKRYTSSSCSLQSCMVSCCMSRKKKLYSS

Amino Acids from 3' Exons

VISQLRILGRSITAGSKFDREIWSNELSPVLNLWKKLNQ,LFHSGFWADPQLVPNLIEKSGLMNFLLSSISGRNT,YFTVEDFGQIHNSWFQIRNLVTFSCPQSLEETKP