McDonnell Genome Institute

Washington University

CircRNA

chr11|103286254|103312033|+|DYNC2H1|ENST00000375735.6

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9431

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

6

Peptide

EETIFLR

Amino Acids from 5' Exons

IALPSLYQTLCFEDAALWRTYYNNSMCEQEFPSILAKKVSLFQQ,LLSPVFIRPSALKMQLCGVLIIIIQCVSKSFHLSLQRKFPYFS,CSPQSLSDPLLRCSSVAYLLFNVARVSIYPCKESFLISA

Amino Acids from 3' Exons

SPPGLKKNLMRTYESWTPEQISKKDNTHRAHALFSLAWFHAACQERRNYIPQ,HLQVRRICVLMSLGLLSKLAKKIIHIELMLSSVLHGFMLHVKKEETIFL,TSRFKEEFNAYLVLDSANQKRYTSSSCSLQSCMVSCCMSRKKKLYSS