McDonnell Genome Institute

Washington University

CircRNA

chr10|98162882|98209899|+|R3HCC1L|ENST00000298999.7

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9923

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

RSFAMLSR

Amino Acids from 5' Exons

RRSFAMLSRLVSKSAQVVCLPRLPKVLGLQ,DGVLPCCPGWCRNPELKWSACLGFPKCWDY,TEFCHVVQAGVEILSSSGLPASASQSAGIT

Amino Acids from 3' Exons

IVVVPCSKNQRDAELEPEGLTWHFMYLKLVGVQYSLRQVMKKKAVVHLTLWKKSKKKVLSPKKKSLKTNRRLEDISILIERSIIVEKKRNLQQNEWTHAFKKQIEFVLREEPLNPKKYYPKDNSREPQMLGLLMHLCRDILNQRRWSVWKLKLRMQDMRGYFFHRPVKSARLKFQANHSKMWNSVTSVGMNLMGKHLKTKIWKAELKLIPRFWRYYMSFLEFLVLSNLRILYQNALILKLYNKACKHQMEYIPAAEASPLLLFLEVQMVSLIKLAILKLRVVVPIVQVSSIKKIQIPFLQLWVTSLCQRAQMTLLVQLENVRRMTALLMSYMSTNLLIQLSLLMKHIEIVDLRMVTLPIKHVWTLQVCPVVIMLLIALMLQLELMRPLLIHEVSQSLEVQMQPLFMLEVGMTLKISATLLLAQIFMVRVFHLILQSQQESRACQIVLPPYLKRLLVVIITLFWTLNSVCMGQKFFQTVPWALTWVVLVIQQKHCTNELPKSSKQKSKMTQGVNLVYLFLIGNHHLWKHPSNQKQLKLLTQRELLPLRRAGSLCLTMMVTAWIHVFYK,LWWCHAARIREMQSSQKAHGTLCTSSGCSTPDRRRKLWFTLCGERKAKRKFSLPKRSLRQTGGSKTKYQSKGALRRKEIFNKIKNGHMPSKNKSLFERNHIQRSIIPRTTAGSPKCWGYNCTFAETFTKEGGVFGSNYGCDRTEDTSFTGLFRNQRGSSSKQTIPKCGILLQATWGSIRQRFGRQNNYQGFGDTIVSSFFCHETEYDCTNKTKLFNCTTKHANIRWNIESQQRRHHHYFCSWKSRWCLSNLRRFSECRWYSQYRFHLRSKRYRFHSCNYGSHLSVREHKHCSSNDRMEEQHCVTCKARTSYSCPCSNTRWIECRHYQSMYDGHYRYVLSCNCPLCSCSNSDLYYTKFLKVCRNECRCNPSSCSKWEHRFQQPFCLLRYLWEYFISFYRVNRKVDRELVRLCFLLTYKKDCWLHFFGLTQYVKWDKSSFRQCRGHPGYWYNRSIARTKNCRRVQNRRARLREYRIWCIFSGIIIYGNIHRTKSNNFSHRGNYCHGELGVYVRWLPGSTSSTR,CGGAMQQESERCRVRARRPDMALYVPKARRGAVLLKTGDEEESCGSPNSVVKEKQKESSLSQKEVFKDKPEARRLNINPDRKEHNCREEKKSSTKLRMDTCLQKTNRVCSKRGTTESKEVLSQGQQQGAPNAGVITNAPLQRHFKPKKVECLEVETTDVTGHERILLSQACLEISEAQVPSKPFQNVEFCDFSRHEPDGEAFEDKDLEGRIETDTKVLEILYEFPRVFSSVMKPENMIVPIKLSSDSEIVQQSMQTSDGILNPSSGGITTTSVPGSPDGVFDQTCVDFEVESVGGIANSTGFILDQKDTDSIPATMGHISLSESTNDTVSPVMIRECEKNDSTADELHVKHEPPDTAVLAHETHRDSGFKNVGDITNKACMMDTTGMSCSDHVTVDSPYVVAVRIADETSINTRSFSKFVGMSADATPLHVARSGNDTEDFSNPSACSDIYGESISSHFTESTGKLIESLSDCASSLPIKKIAGSNYNTFLDSELSMLNGTKVLSDSAVGIDLGSTGDTTEALHELRTAEEFKTEEQDDSGSIEFGVSFPDRESSSMETSIEPKATETSHTEGITAIEESWESMFNDDGDCLDPRLLQE