McDonnell Genome Institute

Washington University

CircRNA

chr10|97468251|97470861|-|MMS19|ENST00000355839.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9691

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

10

Peptide

HSQPPNDPHGIQR

Amino Acids from 5' Exons

TAGTTCVNRTNWCGLVPSCCRQLQVHLPGPVTLSPAMYCLYCWNSSTSTV,LQAPPVTGHETGVACQAVAGSCRCICPGLLCHQQCTAFTAGTVPQAQS,CRHHLCEPDMKLVWPSAKLLQAAAGASARACDSVTSNVLPLLLEQFHKHSQ

Amino Acids from 3' Exons

PPNDPHGIQREDLILSLRAVLASTPRFAE,HLMIPMVSREKTSSVFALCWLLHHDLL,TSPWYPERRPHPESSRCAGFYTTIC