McDonnell Genome Institute

Washington University

CircRNA

chr10|96944112|96949295|+|LCOR|ENST00000356016.7

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9772

18

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

9

Peptide

KSQSEPSEQGTLSR

Amino Acids from 5' Exons

GHLVGLDEPASGAGQEALLKQEQAKIIRFERQAEEFLNAVFYRK,DTSVWMNQLRELGKKLCLNKSKQKSFDSRDKQKNSSMQSFIEK,TLSRSGTSFGSWARSSATRASKNHSIRETSRRIPQCSLLK

Amino Acids from 3' Exons

TVPGSPTPIFPWPVRSCSESNNLLLNIPQKIALLRTPASPIAQRTKACRKHLQSPPLPRLQLLRTLCSANFSWLTKTHLWTLLSESLSQNLANK,QSLGLRPQYSPSGPDHAANDPTICCIYLKKLYSGPQPAQHKEPKPAESISSHHLSHGCNYSEPCAQQTSHGPRLTSGPYCQKVSVRTRT,SPWVSDPNIPLVAREIMQRMIQQFAAEYTSKNSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSKLLMADQDSPLDLTVRKSQSEPSEQ