McDonnell Genome Institute

Washington University

CircRNA

chr10|95632958|95643206|-|ALDH18A1|ENST00000371221.3

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9045

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

8

Peptide

TDLLIVLSDVEDCIQPSVIR

Amino Acids from 5' Exons

VISVKDNDSLAARLAVEMKTDLLIVLSDVE,LLVLKIMIAWLPDWLWKKLISLFFQMK,YCRPGCPTGCGNENSLDCSFRCR

Amino Acids from 3' Exons

IVSSLQSSDMFVLGATSRLSLYPSVVHMASPSPTAVSSMPRESWSSAVPWPEGMNVAWPWGAWHLLLS,LYPAFSHQTCSFLEQHPVYHCTPQSYTWQVLRPPQAEACQENRGEARQCRGDPRGMWPGPGALGIYCA,CIQPSVIRHVRSWSNIPFITVPLSRTHGKSFAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQ