McDonnell Genome Institute

Washington University

CircRNA

chr10|95414493|95432576|-|SORBS1|ENST00000277982.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9752

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

6

Peptide

VSEPDLTGAVSSTTWILQK

Amino Acids from 5' Exons

DATSSSAAQPEVIVVPLYLVNTDRGQEGTARPPTPLGPLGCVPTIPATASAASPLTFPTLDDFIPPHLQRWPHHSQPARASGSFAPISQTPPSFSPPPPLVPPAPEDLRRVSEPDLTGAVSST,MPLPPVQPSRRLSLSTWLILTEGKKALPDLQHLWGLLAASPQSQRLPLPPHLPSRLMISFPLICRGGPTTASQPAPLAPLPPLARRHHPSHHHLRWSLLPRRTSAESRSLTSRELFRV,CHFLQCSPAGGNSCPSLPGYQRARRHCQTSNTSGASWLRPHNPSDCLCRLTSDLPDSRFHSPSSAEVAPPQPASPRLWLLCPHPDATILLTTTSAGPSCPGGPPQSLGAPHGSCFEY

Amino Acids from 3' Exons

TWILQKSALGRERLSGPRLPTGKPQAVALRALRKPGNTKANQ,HGSYKNLHWEGSGDSPGLVFLQGNPKQPCEPSGNPATRKQT,MDLTKICTGKGAVTLRASSSYRETPSSSPASPQETRQHESKP