McDonnell Genome Institute

Washington University

CircRNA

chr10|95410632|95416185|-|SORBS1|ENST00000474353.6

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

18

Peptide

DSLYLSSPKPYVPLGTPR

Amino Acids from 5' Exons

DSSPLLNEVSSSLIGTDSQAFPSVSKPSSAYPSTTIVNPTIVLLQHNR,IPVLYMKFLLPLLELIPKPFHQLASLHPPIPPQRLSILLLCSCNTIE,FQSSTKSFFFPYWNFPSLSISQAFIRLSLHNDCQSYYCALATQS

Amino Acids from 3' Exons

VLSPPRPPLPQKDRFAWQSPTIHNTYKDSLYLSSPKPYVPLGTPRQQNPSQPQPISVLLAAGSAPKGVVCPGSLLPDSTFPSASSQPQQRYAATRTVYHKNVSSNPCHEAVGIKKVSSLYVPCLSNNICLAASENSSRVARDPAEGTPLEAAGTRAPAPGLVSRTAGTGKPPPAPPPDPPKLFFDIRKDAVNRGESPSLGTQASFPDVRPPVLGPRVTSDPENRKSKESYLLQPSYPAK,FSLPHALLSLKRTALHGSPPPSTIPIRIPSTAHQSLMSHSAPPDSRTPHNPSLSLSSWQLDRLPKVWCALVPCFRTPRSPVLHPNPSSAMQPPGQFIIRMALTHVMRQLGLKRSAAYMYLVYPITFAWRRQKTPLVLHVTLPKALPWRLRAPEHRLPALSPAQPAQENHPLLLLLTLPSYSLTSVKMPLTVARVLPWGLRLRSQMDHLCAPGLPLIPKTGRAKNLTFCSRVIQP,SLSPTPSSPSKGPLCMAVPHHPQYLGFPLPELTKALCPTRHPQTAEPLTTPAYLCPPGSWIGSQRCGVPWFLASGLHVPQCFIPTPAALCSHQDSLSECELPMSGSWDKGQQLICTLFIQHLPGGVRKLLSCCTPCRRHSLGGCGHPSTGSRPCLPHSRHRKTTPCSSSPSQAILHPRCRPWRESFPGDSGFVPRCETTCARPPGYLSRKPEEQRILPFAAELSSQ