McDonnell Genome Institute

Washington University

CircRNA

chr10|95339132|95357105|-|SORBS1|ENST00000607232.5

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9303

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

SILLPSEK

Amino Acids from 5' Exons

GERITLLRQVDENWYEGRIPGTSRQGIFPITYVDVIKRPLVKNPVDYMDLPFSSSPSRSATASPQ,VRGSHCSGRMRTGTKGGSRGHPDKASSPSPTWMSSDHWKTLWITWTCLSPPPQVAVPLQAH,EDHTAPAGRELVRREDPGDIPTRHLPHHLRGCDQATTGEKPCGLHGPAFLLLPKSQCHCKPT

Amino Acids from 3' Exons

WIVKVGMLTFLHLQSIAERLTLAMRALCVSTRSPCQLRRPAFRKSFHPNSNPGSLLPALFCRNRRVSSCPQRRLKAVRTFVFLVLMIPKEASPSKWEGALRTCSCAPDGIMTASRAVPASRSTAPAAGGPVLSQERLGCSSPCFIGTCTRSTDLASSWAPSPPPRVCGILPPTLKRVAWHCPGVSWAPARRARNTSPSTPSLPASPLLSSFSGPVPCHPWTCPEGASLPHLCCPGAAPQPARPSPYLSQPSSIPRRWMGTPVGSMLPQHVAIWHTMPASGALCLLSLSPPALMTWTAVQISPLTAEKAVAAVFMEISPNIASTSARAPARPHTPASPPSGSMSSSRPLDSLSGAWMPEGTRAPSSGTSTAPFLSGKSPSTTTPDNLPLVTPQASWWARSQTSPVSPIRTSPLLGGSPWFPHACLPDTPWPGLAAAQSPLRRDPRPWRTTQGPLIMETPCHTQTTAWTGTTTHKVNWHHPVE,GSRWECSHDFFIFSPPNVHQCVRPCVAQEAPVSCEGLHFGNPSIQIQTQALCSQRSFAGTEEYPLALREGSKLEPLCFWFFKFQKRPPPPSGREHEPAHALPTGLQQVEQYHEPPGVQHQRQEALSSLKKGWDAVHHALSGHAPDQPIWPLPGLHLLLLECAGSCLPLKEPGIVQGAGPQPGGLGTHPQAHRLFPHHRFAADSAVPFHAIPGPVRKAEQVSHTCAVPGQPDLSPLGRVPTVNQAPSQGDGWDELQWGLCFPNMQYGTPCLELQGPCAFASLHLLRGPLFKYLHQQRRQWRQCSWRFPQTSPQQVQGHLPGLIHPLHHHPEAAAADLTAVAPGCQRGQEHPPQEHLPNEPPSFPAEKAPPPPPQTTFPWLLRPPGGPEARPPQSAPSGPAPFWGEARGSHTPVFPTHHGQAPQLRALSGETHGPGGLPKGHWKLRAILRPQPGQEQQPTKTGTIPW,DRKGGNAHMISSSSVHSRTFNTSNALGPVCKHKKPLSAAKACISEILPSKFKPRLSAPSALLQEQKSILLPSEKAQSCENLCVSGSLNDSKRGLPLQVGGSIENLLMRSRRDYDSKSSSTMSLQEYSTSGRRPCPLSRKAGMQFTMLYRDMHQINRSGLFLGSISSSSSVRDLASHFEKSSLALSRGELGPSQEGSEHIPKHTVSSRITAFEQLIQRSRSMPSLDLSGRLSKSPTPVLSRGSLTSARSAESLLESTKLHPKEMDGMNSSGVYASPTCSNMAHHALSFRGLVPSEPLSTCSDDVDRCSNISTDSREGSGGSVHGDFPKHRLNKCKGTCPASYTRFTTIRKHEQQQTSRQPEWRLDARGDKSTLLRNIYLMSPLPFRLKKPLHHHPRQPSPGDSSGLLVGQKPDLPSQPHQDQPPSGGKPVVPTRLSSRHTMARLSRSSEPSQERPTALEDYPRAINNGNSVPYSDHSLDRNNNPQSELAPSRG