McDonnell Genome Institute

Washington University

CircRNA

chr10|95339132|95354967|-|SORBS1|ENST00000277982.9

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9216

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

4

Peptide

SATASPQIQNR

Amino Acids from 5' Exons

GERITLLRQVDENWYEGRIPGTSRQGIFPITYVDVIKRPLVKNPVDYMDLPFSSSPSRSATASPQ,VRGSHCSGRMRTGTKGGSRGHPDKASSPSPTWMSSDHWKTLWITWTCLSPPPQVAVPLQAH,EDHTAPAGRELVRREDPGDIPTRHLPHHLRGCDQATTGEKPCGLHGPAFLLLPKSQCHCKPT

Amino Acids from 3' Exons

IQNRQDILYQLITWNPRKNLFEDVMMIK,FRIAKTFYTSLLGIHGRIYSKTSR,SESPRHFIPADYLESTEEFIRRRHDDKE