McDonnell Genome Institute

Washington University

CircRNA

chr10|95336520|95354967|-|SORBS1|ENST00000277982.9

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9711

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

NLFEDVMMIK

Amino Acids from 5' Exons

PWREESGQYERKAERGAGERGPGGPKISKKSCLKPSDVVRCLSTEQRLSDLNTPEESRPGKPLGSAFPGSEAEQTERHRGGEQAGRKAARRGGSQ,HGAKRVDNMRGKQRGGQAKEALVDPRSLRRAASLQTWSGAVLNRDSQISTPLRRAGPASPWVALFQEVRLSRQSGIEVASRRGGKLLGEVGA,MARREWTIEESREGGRRKRPWWTQDLEELLEAFRRGQVPEYTETLRSQHPGEPARQAPGRFSRKGADRAARWRAGGEESCSERWEP

Amino Acids from 3' Exons

IQNRQDILYQLITWNPRKNLFEDVMMIK,FRIAKTFYTSLLGIHGRIYSKTSR,SESPRHFIPADYLESTEEFIRRRHDDKE