McDonnell Genome Institute

Washington University

CircRNA

chr10|93356674|93377429|-|MYOF|ENST00000358334.9

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9702

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

8

Peptide

LEGALQTNIEALK

Amino Acids from 5' Exons

AMEELQDQEGWEYASLIGWKFHWKQRSSDTFRRRRWRRKMAPSETHGAAAIFKLEGAL,PWRNCKTKRAGNMLLLAGNFTGNNVVQIPSAADAGGEKWLLQKHMVQLPSLNLKVP,HGGIARPRGLGICFSNWLEISLETTFRYLPPQTLEEKNGSFRNTWCSCHLTRCP

Amino Acids from 3' Exons

QTNIEALKSGIQGKIPANQLAELWLKLIDEVIEDT,KQIKLNQGYKVKFLQTSWLNCGSMKLKTR,NKYRSSKIRDTRNSCKPAGIVAEADRSYRRHE