McDonnell Genome Institute

Washington University

CircRNA

chr10|93347616|93349969|-|MYOF|ENST00000358334.9

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9282

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

17

Peptide

LPDGFYHIPQSCCGVWR

Amino Acids from 5' Exons

FLPKEELYMPPLVIKVIDHRQFGRKPVVGQCTIERLDRFRCDPYAGKEDIVPQLK,SCPRRNCTCPHWSRSSTTGSLGGSLSSASAPSSAWTAFAVTLMQGKRTSSHSSK,LAQGGIVHAPTGDQGHRPQAVWAEACRRPVHHRAPGPLSLPLCRERGHRPTAQ

Amino Acids from 3' Exons

ILAWGLRNMKNFQMASITSPSLVVECGGERVESVVIKNLKKTPNFPSSVLFMKV,FLGAEIKTSRWLLSHPPVLLWSVEEKGWNRWSKTLRRHPTFQVLFSSK,SSLGLKKYEKLPDGFYHIPQSCCGVWRRKGGIGGDQKPEDTQLSKFCSLHES