McDonnell Genome Institute

Washington University

CircRNA

chr10|93333220|93374955|-|MYOF|ENST00000358334.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9562

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

20

Peptide

DHYIPNTLNPVFGRYTLPLTEGKANVTVLDTQIR

Amino Acids from 5' Exons

CDPYIKITLGKKVIEDRDHYIPNTLNPVFG,VTLTKHWAKKSLKTEITTFPTLSTQSLA,PLHKNNTGQKSHRPRSLHSQHSQPSLWQ

Amino Acids from 3' Exons

IHVASHRRKSQRHSSRYSDPKAAVQVSLPNTGGCEDEVGSHRCEVHTGRNGLAINAADR,YTLPLTEGKANVTVLDTQIRKLRSRSLSQIHEAAVRMRSEATDVKSTLAEIEDWLDKLMQLTEE,TRCLSQKEKPTSQFSILRSESCGPGLSPKYMRRLGGRKPQMSPHWQKLRTGLINCSLK