McDonnell Genome Institute

Washington University

CircRNA

chr10|92934309|92974232|+|EXOC6|ENST00000260762.10

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9743

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

ISNQGIH

Amino Acids from 5' Exons

VLCGRRSHFTCDPRISNQGIHTLEHGPLKDNCCPSSF,FFVVEDHILHVTQGLVTRAYTDELWNMALSKIIAVLRAHS,SLWKITFYMPKDPGHTLMNFGTWPSQRLLSLELI

Amino Acids from 3' Exons

DARHAAEGEIYTKLNQKIDEFVQLADYDWTMSEPDGRASGYLMDLINFLRSIFQVFTHLP,MLDMQQKEKYIPNIKKLMNLFSLLIMTGQCLSQMEELVVIWTLIFEASFKCLLIC,CSTCSRRRNIYQTESKNICSACLLDNVARWKSWLFNGPYKFFEKHLSSVYSFA