McDonnell Genome Institute

Washington University

CircRNA

chr10|92639793|92645642|+|KIF11|ENST00000260731.4

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.956

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

9

Peptide

EQELHNLLEELCK

Amino Acids from 5' Exons

ELCKLMNLWTERFCALEEKCENIQKPLSSVQENIQ,NFASIFGQRDSVLWRKSVKIYRNHLVVSRKIYS,TLQVNESLDREILCFGGKVKYTETTCPGKYTA

Amino Acids from 3' Exons

EIGYSQQNDFSQSKILCFWLLTGTQKFPRRYKIGRICETLTQWQPGKNISRDTEMISEHKNSLFFTVGIFLKKGTGTSQLIG,KSKDIVNKMTFHSQKFCADSDGFSQELRNFNQEGTKLVEESVKHSDKLNGNLEKISQETEQRCESLNTRTVYFSEQWVSSLNEREQELHNLLE,NLRISTKLFTVKNFVLILMASHRNSEILTKKVQNWLKNLNTLINSMATWKKYLKRLNRDVNLTQEQFIFLNSGYLPMKGNRNFTTYW