McDonnell Genome Institute

Washington University

CircRNA

chr10|92144944|92240361|-|CPEB3|ENST00000265997.4

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9355

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

12

Peptide

KVFVGGLPPDIDEAAQTMQDDLLMDK

Amino Acids from 5' Exons

MPSWMIAMVIKPCHLAVLPLAVKMGNENATLERCLLEDFLLILMK,CLPGPWSSLVIWLKFSHSLSKWGTSRTLLKGVCWRTSSY,AFLDDSHGDQALSSGLSSPTRCQNGERVERYSRKVFVGGLPPDIDE

Amino Acids from 3' Exons

LRKPCRMIYWTKAKPSPSPSSSSGSSSSPNLSPAYPKPRPRPSPQRPPSRRKTAQCRPSAQPLPPRPPTARTRCRWNHRSCQAVSISLLSSRRRLRSPRHRARRCRRPSAAPGPRAPPTRRTASSRGSPQSTGPCSSRTSRTMSTQSSEALSPRRSAWRRPSTTSSRRRLRPRRSRHSQRSHHRRSPRSSAAHPPAPARRPTRRGAPPRRTATSPSPASRPRLRRLQPLLPQPPPRRPRPAGTRTKAMQPGAHRPTPGAACRRAGTLAGRSVWAWVWVSGCLPRSTPSRRSKSPSPATSRRPSSLARPLSLPSPGWRITLSGPIMVTICCHF,CANHAGFTDGQKQNPAPAPAAAAAAAAAPTVQRIRSPVHAPLLRDPQAGGKQRSAGPQPSRCPPGPQRPGQDADGITAPARLEFPSASSAAAAASGARGTGRVAVAVLRQHLVHGHHQRGRGQLLPGDHPSQRDHALPELPAPCQPSLRRHFLPADRPGADPAPPAAAAACARAAAGTASAATTGAAPAAAPLTRQPQPGALRAEERRRGVRPPAHHDQQAVLVFGGCSRCCRSRRLVGLVQLEHAPKRECSLERTVQPLGRPAGGPGPSPGGRCGRGCGCRGAFPAQPHLAAQKALLQQRDRAAQVPSRGPSHFQVLDGGRFPDRWQSVAIS,AQTMQDDLLMDKSKTQPQPQQQQRQQQQPQPESSVSEAPSTPLSSETPKPEENSAVPALSPAAAPPAPNGPDKMQMESPLLPGLSFHQPPQQPPPPQEPAAPGASLSPSFGSTWSTGTTNAVEDSFFQGITPVNGTMLFQNFPHHVNPVFGGTFSPQIGLAQTQHHQQPPPPAPAPQPAQPAQPPQAQPPQQRRSPASPSQAPYAQRSAAAAYGHQPIMTSKPSSSSAVAAAAAAAAASSASSSWNTHQSVNAAWSAPSNPWGGLQAGRDPRRAVGVGVGVGVGVPSPLNPISPLKKPFSSNVIAPPKFPRAAPLTSKSWMEDNAFRTDNGNNLLPFQ