McDonnell Genome Institute

Washington University

CircRNA

chr10|91953736|91997751|+|BTAF1|ENST00000265990.10

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9736

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

5

Peptide

LMPLETLQAAELIDSEFR

Amino Acids from 5' Exons

TLQAAELIDSEFRAGMSNRQKNKAKRMAKLFAKQRSRDAVETNEK,LFRQLNLTQSFEQEAIDKRTKLKEWPSYLQNRDPGMQWKLMRR,SSGSIDLRVSSRNEQTKEQSKNGQVICKTEIQGCSGNEE

Amino Acids from 3' Exons

VWNNMLVLFHILSFLFLYEEVIRQTVDSWPRSALQRLDSCHL,CNGTTRCWYCSIYCPFSCSCIRKNESDRQCEIHGHAVLCNANTHAT,VMEQLDVGIVPYIVLLVVPVLGRMSDQTDSVRFMATQCFATLIRLMPLE