McDonnell Genome Institute

Washington University

CircRNA

chr10|87776320|87814612|-|ATAD1|ENST00000308448.11

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9937

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

2

Peptide

MDWILITAAR

Amino Acids from 5' Exons

TPFYETVQVLTMKLQPKLSLVSGMDWILITAA,LLSTKPFKFPSYSHDESSVYESLGWIGYSQLP,SFLRNRSSSDHEATAMMKAQFMSLWDGLDTDHSCQ

Amino Acids from 3' Exons

VNIQDGTCSLFSSFESESCWFNFPFDNIWCSDILYYQMDGRCNSNQKAKSRSSET,LTFKMVHAEAFSRPLSRNEVVGLIFRLTIFGAVTYFTIKWMVDAIDPTRKQKVEAQKQ,HSRWYMLKPFLVLVGMKLLVFSVQYLVQHTLLSNGWMQLIQPESKKKLRN