McDonnell Genome Institute

Washington University

CircRNA

chr10|86687068|86692571|+|LDB3|ENST00000263066.10

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9472

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

FNPSALK

Amino Acids from 5' Exons

RRLPGTLQPQCPEGLGPVHPQAHRGEGAGRQGHHHPCAVQHAHQHVFPGCHHGCHRWAGPSPRQLQW,ADYQERFNPSALKDSALSTHKPIEVKGLGGKATIIHAQYNTPISMYSQDAIMDAIAGQAQAQGSDFS,PTTRNASTPVPRTRPCPPTSPSRRGWAARPPSSMRSTTRPSACIPRMPSWMPSLGRPKPKAVTSV

Amino Acids from 3' Exons

CKTLMKKLCEGQ,ARPRSSAKVK,QDPDEEALRRS