McDonnell Genome Institute

Washington University

CircRNA

chr10|86680081|86687272|+|LDB3|ENST00000263066.10

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

17

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

13

Peptide

DSALSTHKPIEVK

Amino Acids from 5' Exons

IKASHSHLHDSTSSPDPSAGDPSPE,SKRPIPISTTAPPVQTPLPVIPHQK,QSVPFPSPRQHLQSRPLCRSLTR

Amino Acids from 3' Exons

RRLPGTLQPQCPEGLGPVHPQAHRGEGAGRQGHHHPCAVQHAHQHVFPGCHHGCHRWAGPSPRQLQW,ADYQERFNPSALKDSALSTHKPIEVKGLGGKATIIHAQYNTPISMYSQDAIMDAIAGQAQAQGSDFS,PTTRNASTPVPRTRPCPPTSPSRRGWAARPPSSMRSTTRPSACIPRMPSWMPSLGRPKPKAVTSV