McDonnell Genome Institute

Washington University

CircRNA

chr10|814636|817889|-|LARP4B|ENST00000448368.5

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9996

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

LWCEQTLR

Amino Acids from 5' Exons

SQGGGETEGNPQCGQTSFRPHCDRVIGAGERSRHGTYLVPAFLHDSREALVTDAAHSCTCSFFNHIF,DPKVAEKQRETHSVDRLPSALTATACKSVQVNGAATVRTSCLPSCTTAARLWCEQTLRTPAPARFLITSNL,IPRWRRNRGKPTVWTDFLPPSLRPRVNRCRTEPPRYVPRACLPARQPRGSGVNRRCALLHLLVFSHLI

Amino Acids from 3' Exons

SSQTQSPTPPKPPSPSFELGLSSFPPLPGAAGNLKTEDLFENRLSSLIIGPSKER,AARHSLQRHQSLRRQASSWGCPASLHYLELPAIRQRTCLKTGYLADHPKK,QPDTVSNATKASVAKLRAGAVQLPSITWSCRQFEDRGLVKQAILDNRTIQRK