McDonnell Genome Institute

Washington University

CircRNA

chr10|80507227|80509471|+|TSPAN14|ENST00000372156.5

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9817

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

AGVLSDLTK

Amino Acids from 5' Exons

GVLSDLTKVTRMHGIDPVVLVLMVGVVMFTLGFAGCVGALRENICLLNF,VCCPTSPKPGCMESTLWCWSWWAWCSPWGSPAAWGLCGRISACST,CAVRPHQSDPDAWNRPCGAGPDGGRGDVHPGVRRLRGGSAGEYLLAQL

Amino Acids from 3' Exons

FCGTIVLIFFLELAVAVLAFLFQDWVRDRFREFFESNIKSYRDDIDLQNLIDSLQKA,SVAPSCSSSSWSWLWPCWPSCSRTGGTGSGSSSRATSSPTGTISICKTSSTPFRK,LWHHRAHLLPGAGCGRAGLPVPGLGEGPVPGVLREQHQVLPGRYRSAKPHRLPSES