McDonnell Genome Institute

Washington University

CircRNA

chr10|80425865|80427496|+|FAM213A|ENST00000372181.1

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9665

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

3

Peptide

QEAADLSSLK

Amino Acids from 5' Exons

EAADLSSLKSMLDQLGVPLYAVVKEHIRTEVKDFQPYFKGEIFLDEK,KLRICPPKACWTSWASPSMQWRSTSGLKRISSLISKEKSSWMK,SCGSVLPEKHVGPAGRPPLCSGKGAHQDSEGFPALFQRRNLPGK

Amino Acids from 3' Exons

KKFYGPQRRKMMFMGFIRLGVWYNFFRAWNGGFSGNLEGEGFILGGVFVVGSGKQ,KSSMVHKGGRCLWDLSVWECGTTSSEPGTEASLETWKEKASSLGEFSWWDQES,KVLWSTKAEDDVYGIYPSGSVVQLLPSLERRLLWKPGRRRLHPWGSFRGGIRKA