McDonnell Genome Institute

Washington University

CircRNA

chr10|77999980|78002308|-|POLR3A|ENST00000372371.7

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9974

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

5

Peptide

TAETGYMQALILK

Amino Acids from 5' Exons

LPAAKGFVANSFYSGLTPTEFFFHTMAGREGLVDTAVKTAETGYMQ,SQLPKALWLIAFIPVHQLSFSSTQWPAGKVSTRLRQLKRDTC,PSCQRLCGLLFRFDTNVFLPHNGRPGRSSRHGCKDSNGIHA

Amino Acids from 3' Exons

ALILKELSVIRDHAGSACLRELDKSNSPLTMALCGSK,HSRSCLSVTTLAVPASGSWTRATAPSPWLCAAPK,TDPEGAVCDPPRWQCLPPGAGQEQQPPHHGSVRLQ