McDonnell Genome Institute

Washington University

CircRNA

chr10|77794007|77796188|-|DLG5|ENST00000372391.6

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9035

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

11

Peptide

YFTEVMKASQQAIER

Amino Acids from 5' Exons

GAERPHLPEGQGDSEAFQRAVGGAEAAGVQQVLH,EQRDPIYLRDKVTQRHSKEQFEAAQKLEQEYSRYFT,SRETPSTGTRLRGIPKSSLRRRRSLSRSTAGTSQ

Amino Acids from 3' Exons

RRPPSRPLSGVSKIACLSTISGEAAISMPLWRQRRSQK,GDEGLPAGHAGCQRLPVCRLAEKRPFRCDHCGVNKGDHRK,VMKASQQAIERGVKDCLFVDYKRRSGHFDVTTVASIKEITEK