McDonnell Genome Institute

Washington University

CircRNA

chr10|77001406|77090510|-|KCNMA1|ENST00000286628.12

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9524

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

23

2

Peptide

LIADVLSVTAHACQAVCVVTWTPLR

Amino Acids from 5' Exons

PRCPSTREDGHVVLIADVLSVTAHACQAVCVVTWTPLREPSHFLLSLLMIAPPVSVP,QDVHLQENETGMLFLRTFALLMHVRPCAWRGHPESLPTFFCLCLLHQFPC,KMSIYKRMRRACCFDCGRSERDCSCMSGRVRGNVDTLERAFPLSSVSVNDCSTSFRA

Amino Acids from 3' Exons

AHCGLRTHHSGECFQLPEGLSAQGPGRQCGDRFSSQ,HIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLH,TLWSADTSLWRVFPTSRTFCTRTGMTSMWRSFFFT