McDonnell Genome Institute

Washington University

CircRNA

chr10|76944772|77121048|-|KCNMA1|ENST00000286627.9

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9092

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

17

2

Peptide

SMQFDDSIGVLQANSQGLR

Amino Acids from 5' Exons

GTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQ,VRHVGLIGLSTSTSVTCALSCQPIRIILMILRCRTRNASWRHSTSNLCSLMTASESCRLIPK,YAIKSGFKGCQHQPLHVRYPVSQSEYYFAAGQGMHLGVTQHQIYAVQHRSLAGFP

Amino Acids from 3' Exons

VDFELDYSFQKFCSFIFLKQ,FEIFKSSETDTVFRNFAVSEYSNK,LRFLRALRLIQFSEILQFLNILKT