McDonnell Genome Institute

Washington University

CircRNA

chr10|76887290|76970067|-|KCNMA1|ENST00000372403.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9997

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

11

Peptide

IEDEQPSTLSPK

Amino Acids from 5' Exons

VCHHQPALVARADGPDLLLNAVPQCRPVPGQPVPFLPLVAVLQQEELLCSLHPIHSKPTEPAQVQGVPGQTE,YVITNPPYEFELVPTDLIFCLMQFDHNAGQSRASLSHSSHSSQSSSKKSSSVHSIPSTANRQNRPKSRESRDKQ,MSSPTRPMSLSSCRRTSSACSLTTMPASPGPACPIPPTRRSPPARRAPLFTPSHPQQTDRTGPSPGSPGTNR

Amino Acids from 3' Exons

LKMSSRQHYHQKKSNGMEACGTHPTPRLS,RAAVNTITKKKATEWRHAELTQHLAADE,EDEQPSTLSPKKKQRNGGMRNSPNTSPKLM