McDonnell Genome Institute

Washington University

CircRNA

chr10|7579754|7580064|-|ITIH5|ENST00000397145.6

Cancer

Type of Peptide

GBM

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9691

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

LPDGWEAHGR

Amino Acids from 5' Exons

AQTSTGPCRGPSGSSTSTWPTVALETGACPSSSSRMGSPRSGRRTPSRSSTTPERPPEAKSASSPLASATTWTSGCWRNCRWRTVASHGACTRRRTQARSSS,HRHQRGPAEGHQAPQQVRGPQWHWRPERVPHRLPDGWEAHGRGDAHPQDPQQHPRGRPRPSLHLHHWHRQRRGLQAAGETVAGELWPHTARARGGGRRLAAHR,TDINGALQRAIRLLNKYVAHSGIGDRSVSLIVFLTDGKPTVGETHTLKILNNTREAARGQVCIFTIGIGNDVDFRLLEKLSLENCGLTRRVHEEEDAGSQLI

Amino Acids from 3' Exons

AQTSTGPCRGPSGSSTSTWPTVALETGACPSSSSRMGSPRSGRRTPSRSSTTPERPPEAKSASSPLASATTWTSGCWRNCRWRTVASHGACTRRRTQARSSS,HRHQRGPAEGHQAPQQVRGPQWHWRPERVPHRLPDGWEAHGRGDAHPQDPQQHPRGRPRPSLHLHHWHRQRRGLQAAGETVAGELWPHTARARGGGRRLAAHR,TDINGALQRAIRLLNKYVAHSGIGDRSVSLIVFLTDGKPTVGETHTLKILNNTREAARGQVCIFTIGIGNDVDFRLLEKLSLENCGLTRRVHEEEDAGSQLI