McDonnell Genome Institute

Washington University

CircRNA

chr10|74089195|74095855|+|VCL|ENST00000211998.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

11

Peptide

ALASQLQDSLKR

Amino Acids from 5' Exons

RTRILTGGHAESSAGISGSGCAHSKSGKCSSQAGSHDQLKAEHCKEDRCCS,GQGSSPVAMQKAQQVSQGLDVLTAKVENAARKLEAMTNSKQSIAKKIDAAQ,DKDPHRWPCRKLSRYLRVWMCSQQKWKMQLASWKPPTQSRALQRRSMLL

Amino Acids from 3' Exons

VRLPSGGLWPKGIVWLMLWGLIGKIFSPSVTEWTSQPSWLTWLPEGKGRVLRHEHLHLSSKTP,SGCHPGACGRRASSGCYDGALSARSSRQVPSGPADSPAGPGCQRGRGESSGTSTCISAPRLLK,QAAIRGLVAEGHRLANVMMGPYRQDLLAKCDRVDQLTAQLADLAARGEGESPQARALASQLQDSLK