McDonnell Genome Institute

Washington University

CircRNA

chr10|74082453|74089349|+|VCL|ENST00000211998.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9488

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

5

Peptide

IDAAQDTEAMK

Amino Acids from 5' Exons

DTEAMKRALASIDSKLNQAKGWLRDPSASP,TLKPREHWPPTPNTRPKVGSVTLVPPQ,HSHEESIGLHRLQTEPGQRLAPPCLP

Amino Acids from 3' Exons

RTRILTGGHAESSAGISGSGCAHSKSGKCSSQAGSHDQLKAEHCKEDRCCS,GQGSSPVAMQKAQQVSQGLDVLTAKVENAARKLEAMTNSKQSIAKKIDAAQ,DKDPHRWPCRKLSRYLRVWMCSQQKWKMQLASWKPPTQSRALQRRSMLL