McDonnell Genome Institute

Washington University

CircRNA

chr10|73243842|73246828|-|DNAJC9|ENST00000372950.4

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9085

15

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

4

Peptide

AAIQILGK

Amino Acids from 5' Exons

AQEEAKEAEMSRKELGLDEGVDSLKAAIQ,LRKRPKKQKAERSWGLMKAWIARQPF,SGRGQRSRNEQKGVGARRGPEGSHS

Amino Acids from 3' Exons

ILGKVYSVLSDREQRAVYDEQGTVDEDSPVLTQDRDWEAYWRLLFKK,SWEKSIPFSVTENREQCTMSREQWTRTLLCSPKTETGRRIGGYSLK,PGKSLFRSQQRTESSVRAGNSGRGLSCAHPRPRLGGVLAATLK