McDonnell Genome Institute

Washington University

CircRNA

chr10|73230421|73233163|+|FAM149B1|ENST00000242505.10

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9996

15

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

7

Peptide

KSSEEPEYESLSSK

Amino Acids from 5' Exons

MSLCQASRHQPNVNDLLVHGMPLQPRNLSLMDKL,VSVKQADISQMMISWFMECLYSQEISPWTSS,ESLSSKQTSAKCESLGSWNASTAKKSLPNGQAP

Amino Acids from 3' Exons

RSQATYEAWVQYHPFNSKLAKSSCGVYIISVIHSAVHQETQSTTTNSSSDQHEPFMCNTKICGRNPQRSPS,DLDDKLLMRPGSSTILSTRNWPNRAVEFSTSSLSYTVQSTRRRNPPPRTLHPISTSHSCAETPRSVEEILRGAR,ILMTSYLGLGPVPSFQLEIGQIELWSLVHHLCHTQCSPPGDAIHHHELFIRSARAIHVLKHQDLWKKSSEEPE