McDonnell Genome Institute

Washington University

CircRNA

chr10|73174686|73235318|+|FAM149B1|ENST00000242505.10

Cancer

Type of Peptide

BRCA-Basal-like

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9949

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

ATLVELKVR

Amino Acids from 5' Exons

ERNNKTCSPSSPSREAGGNFPHQQSERHKFPK,KGITKHALNHHPPPEKLEEISPTSDSHEKDTSSQ,KEQNMLLTIIPLQRSWRKFPPPVTVMRKTQVPK

Amino Acids from 3' Exons

KPHGDSSRAQSAVVDEPNYQQPQERLLLPDFFPRPNTTQSFL,NPMATLVELKVRWWMNLTISSHKKGSFCPTFSPGPTQLNHF,TPWRLSSSKCGGGTLSAATRKAPFARLFPQAQHNSIIF