McDonnell Genome Institute

Washington University

CircRNA

chr10|73043886|73047101|-|P4HA1|ENST00000263556.3

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9995

26

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

1

Peptide

LTTAQYR

Amino Acids from 5' Exons

LSRATVHDPETGKLTTAQYRVSK,AELQYMTLRLENPQHSTEYLR,EPSYSTPDWKIDHSTVQSIE

Amino Acids from 3' Exons

TPRRQKKLFCRYHDGNRNPKFILAPAKQEDEWDKPRIIRFHDIISDAEIEIVKDLAKPR,PLGDRKNSFAATMMETVILNLFWLQLNRRMNGTSLVLFASMILFLMQKLKSSKTQNQ,PSETEKTLLPLPWKPSIYSGSSTGGMGQASYYSLPYYFCRNNRQRPSKTK