McDonnell Genome Institute

Washington University

CircRNA

chr10|73030270|73047101|-|P4HA1|ENST00000263556.3

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9516

34

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

16

3

Peptide

IQDLTGLDVSTAEELQTPR

Amino Acids from 5' Exons

CLALWLKSCGVSNYENTRSNRTRCFHSRGIT,AWLSGYENPVVSRINMRIQDLTGLDVSTAEELQ,PGSLAMKILWCLELIEYKIQDMFPQQRNY

Amino Acids from 3' Exons

TPRRQKKLFCRYHDGNRNPKFILAPAKQEDEWDKPRIIRFHDIISDAEIEIVKDLAKPR,PLGDRKNSFAATMMETVILNLFWLQLNRRMNGTSLVLFASMILFLMQKLKSSKTQNQ,PSETEKTLLPLPWKPSIYSGSSTGGMGQASYYSLPYYFCRNNRQRPSKTK