McDonnell Genome Institute

Washington University

CircRNA

chr10|72274156|72274421|+|DDIT4|ENST00000307365.3

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9277

16

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

HSEFISK

Amino Acids from 5' Exons

RLLRSGTLSSSANALASVLTMPSLWDRFSSSSTSSSPSSLPRTPTPDRPPRSAWGSATREEGFDRSTSLESSDCESLDSSNSGFGPEE,GFYAPALVHQQTPWRLSSPCLAFGTASRRRPPPLRPRPCPELPPQIGRRAQPGGRRPGRRGLTAPRAWRARTASPWTAATVASGRRK,ASTLRHSEFISKRPGVCPHHAPLGPLLVVVHLLFALVLAPNSHPRSAAALSLGVGDPGGGVPLHEPGELGLRVPGQQQQWLRAGG

Amino Acids from 3' Exons

RLLRSGTLSSSANALASVLTMPSLWDRFSSSSTSSSPSSLPRTPTPDRPPRSAWGSATREEGFDRSTSLESSDCESLDSSNSGFGPEE,GFYAPALVHQQTPWRLSSPCLAFGTASRRRPPPLRPRPCPELPPQIGRRAQPGGRRPGRRGLTAPRAWRARTASPWTAATVASGRRK,ASTLRHSEFISKRPGVCPHHAPLGPLLVVVHLLFALVLAPNSHPRSAAALSLGVGDPGGGVPLHEPGELGLRVPGQQQQWLRAGG