McDonnell Genome Institute

Washington University

CircRNA

chr10|70873350|70875548|+|SGPL1|ENST00000373202.7

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9998

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

2

Peptide

STGTISSSSIQIGR

Amino Acids from 5' Exons

YGYAPKGSSLVLYSDKKYRNYQFFVDTDWQGGIYASPTIAGSRPGGISAACWAALMHFGENGYVEATKQIIKTARFLKS,MAMPQKAHHWCCIVTRSTGTISSSSIQIGRVASMLPQPSQAHGLVALAQPVGLPCTSVRTAMLKLPNRSSKLLASSSQ,WLCPKRLIIGVVQEVQELSVLRRYRLAGWHLCFPNHRRLTAWWHRSLLGCLDALRERLCSYQTDHQNCSLPQVR

Amino Acids from 3' Exons

TGKYQRHLCFWESPIVSHCSGIPFHLPTIKPDDCGVELEPVAVPTQ,LENIKGIFVFGNPQLSVIALGSRDFDIYRLSNLMTAKGWNLNQLQFPP,WKISKASLFLGIPNCQSLLWDPVILTSTDYQTLLRGGTTSCSSHP