McDonnell Genome Institute

Washington University

CircRNA

chr10|70090059|70095753|+|H2AFY2|ENST00000373255.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9997

50

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

18

Peptide

VEGIVHPTTAEIDLKEDIAEILELAGNAAR

Amino Acids from 5' Exons

RKFNWPAMPRGTTRRPGPRDTSCWQLPMTRSST,GNSRIGRQCREGQQEGPDSPETHLAGSCQRGAQP,EILELAGNAARDNKKARIAPRHILLAVANDEELNQ

Amino Acids from 3' Exons

LSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDI,CPPRVTSAILAPEWRALSTQPQPKLTSKKI,VLNPEHQPYWLHESGGHCPPNHSRNPQRRY