McDonnell Genome Institute

Washington University

CircRNA

chr10|69382486|69382791|+|HK1|ENST00000298649.7

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.954

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

7

Peptide

TPDGTGIPGVSTR

Amino Acids from 5' Exons

VFPAFPQDSKALGARLRCALPPLGEWQRQGGCHGDGGGLPLGRAAPADRGDPGSFPPHQGHAAGGEEEDAGRDGAGAEEADAQQCRGDAALLRPENSRRD,YSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLTKDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGT,IPGVSTRLGAWCQTPMCASSSRRVAAARGLPWRRWPTAWPSSTGRRRPWLISTSPRTCCWRRRGCGPRWSWGGSRRTTMPWLRCCPPSSGELPTGP

Amino Acids from 3' Exons

VFPAFPQDSKALGARLRCALPPLGEWQRQGGCHGDGGGLPLGRAAPADRGDPGSFPPHQGHAAGGEEEDAGRDGAGAEEADAQQCRGDAALLRPENSRRD,YSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLTKDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGT,IPGVSTRLGAWCQTPMCASSSRRVAAARGLPWRRWPTAWPSSTGRRRPWLISTSPRTCCWRRRGCGPRWSWGGSRRTTMPWLRCCPPSSGELPTGP