McDonnell Genome Institute

Washington University

CircRNA

chr10|69359896|69384481|+|HK1|ENST00000298649.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9384

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

15

Peptide

IYAIPIEIMQGTGEEK

Amino Acids from 5' Exons

KREISLPWILVGLPFEFCGCKIMRKTRMFTWSPRFMTPQRTSCTAVEA,KGRFHCPGSWWVFLSNSAGASESEKPECSHGVRGLHPREHRARQWKP,KGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQ

Amino Acids from 3' Exons

RMVTSWPWILEEPISVCCWKSVVGKRERWKCTTRSTPFLLKSCRALGK,EWLLGPGSWRNQFPCAAGENPWEKENGGNAQQDLRHSYNHAGHWGR,NGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEE