McDonnell Genome Institute

Washington University

CircRNA

chr10|69200279|69203043|+|SUPV3L1|ENST00000359655.8

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.945

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

FSAQLLSTR

Amino Acids from 5' Exons

EHKENYFLLPYKAQYQKGRERTRTNHNLSSPADCWQSWQIQLTVRRRGYNNESRSQFIKGNFEEACGSYK,SIRRIIFYSLIKPSINEKGERELEPITTSQALQIAGRAGRFSSRFKEGEVTTMNHEDLSLLKEILKRPVDPIR,AGELFFTPLSPVSMKRERENNQSQPLKPCRLLAELADSAHGLKKERLQQIMKISVYRKFRGLWIL

Amino Acids from 3' Exons

DIFVDFSQVDGQYFVCNMDDFKFSAELIQHIPLSLRVRYVFCTAPINKKQPFVCSSLLQ,IFLTFHKLMGSILSAIWMILNFLQSSSIFHVCEGMFSAQLLSTRSSLLCVLHCY,YFCRLFTSWAVFCLQYGFIFCRVDPAYSTKSASEVCFLHSSYQQEAAFCVFFTVT