McDonnell Genome Institute

Washington University

CircRNA

chr10|68971890|68977688|+|DDX21|ENST00000354185.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9272

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

7

Peptide

SLINSNVDAQSLHGDIPQK

Amino Acids from 5' Exons

DAQSLHGDIPQKQREITLKGFRNGSFGVLVATNVAARGLDIPEVDLVIQSSPPK,MLSPCMETFHRSKGKSPKVLEMVVLEFWWQPMLLHVGTSLRLIWLYKALHQ,CSVLAWRHSTEAKGNHPERFKWFWSFGGNQCCCTWVRHPGFGYTKLSTK

Amino Acids from 3' Exons

AFGFRASHCHSLQTISEADRGEGSCGSSGSSTGPYFRCHVRRPALLDQLKC,LLDSVPPTAISHFKQSAEKLIEEKGAVEALAAALAHISGATSVDQRSLINSNV,FWIPCLPLPLVTSNNQLRSRRRELWKLWQQHWPIFQVPRPTSAPSTQM