McDonnell Genome Institute

Washington University

CircRNA

chr10|68906225|68907007|+|DDX50|ENST00000471475.1

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9958

17

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

3

Peptide

LEESFMDIAISDK

Amino Acids from 5' Exons

SFMDIAISDKGLWTCTSLIGLLRFKQDKLKTHYTVL,ALWISQFRIRDYGPVLPLGCYEDLNKISKHITQCW,LYGYRNFGGIMDLYFPYRVVMKITRAENTLHSA

Amino Acids from 3' Exons

SDRRKSRHHYDSDEKSETRENGVTDDLDAPKAKKSKMKEKLNGDTEEGFNRLSDEFSKSHKSRRKDLPNGDIDEYEKKSKRVSSLDTSTHKSSDNKLEE,VTEGSQGTIMTRMRNQKQEKMVLQMTWMLPRPKNLKKRSMETLKKDLIDFQMNSPNLISQEEKIYQMEIMNMKKNQSEYHLILLLINQVIINR,QKEVKAPLLGEIRNKRKWCYRPGCSQGQKINEREAKWRHRRITFRILQISVKKKRSTKWRYRIKKIKASIIFRYFYSIKTRG