McDonnell Genome Institute

Washington University

CircRNA

chr10|68722454|68786692|+|CCAR1|ENST00000265872.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9512

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

AQIDAIEDK

Amino Acids from 5' Exons

IDAIEDKQGKVFFPFASWLNLEDRRIRHGLLSLQPLQYHSQ,SMLKTNKGRFFFLLHHGSIWRTEESAMGYSVYSHCSITA,RCYRRQTREGFFSFCIMAQFGGQKNPPWATQFTATAVSQP

Amino Acids from 3' Exons

EKEKTQMITINRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQ,KKKRLKSQLTEICWLLFILIKVIVVTFLKRIWKKYFILLDYIFLGL,KRKDSNDHNQRSVNGFCLFSKSLWLPSKGFGRNTLYSWTTSFSGS