McDonnell Genome Institute

Washington University

CircRNA

chr10|68722454|68766079|+|CCAR1|ENST00000265872.10

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9737

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

5

Peptide

EHSFEIDAIEDK

Amino Acids from 5' Exons

IDAIEDKQGKVFFPFASWLNLEDRRIRHGLLSLQPLQYHSQ,SMLKTNKGRFFFLLHHGSIWRTEESAMGYSVYSHCSITA,RCYRRQTREGFFSFCIMAQFGGQKNPPWATQFTATAVSQP

Amino Acids from 3' Exons

EEERKRQEEIERQRRERRYILPDEPAIIVHPNWAAKSGKFDCSIMSLSVLLDYRLEDNKEHSFE,KKKGNVKRKNASVEKEDIFCLMNRPSLYIQIGLQKVASLIVASCLVSYWTTDRIIKNIHL,RRKETSRGNRTPASRKKIYFATGHHCTSKLGCKKWQVLHHVFECPIGLQIRGRTFI