McDonnell Genome Institute

Washington University

CircRNA

chr10|68288482|68289019|-|PBLD|ENST00000309049.8

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9369

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

18

Peptide

YFAPWVGVAEDPVTDCHRQHTGPGHLLFSRYPK

Amino Acids from 5' Exons

VVSGEPESEHGESAASKHREGERAYSYPRRAWWADPSILLLKIFCTVGWCGRPSD,SFLENLKVNTENLLQVENTGKVKGLILTLKGEPGGQTQAFDFYSRYFAPWVGVAEDPVT,RFWRTKTRRICCKLKTQGRKGLFLPLKESLVGRPKHLTFTQDILHRGLVWLKTQQ

Amino Acids from 3' Exons

TAIGNTLVQDICYSPDTQKLLVRLSDVYN,LPATHWSRTSVILQIPKSSSSASVTFTT,CHRQHTGPGHLLFSRYPKAPRPPQRLQQ