McDonnell Genome Institute

Washington University

CircRNA

chr10|67990903|68014186|-|HERC4|ENST00000277817.10

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9677

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

3

Peptide

MLLGFYSTNLYNLIIRR

Amino Acids from 5' Exons

QSLNRYQIFRGYECCAFIPQTYTTSSADISA,NDDHYRTGTRFSGVDMNAARLLFHKLIQPDHPQISQQ,MMITIEQVPDFQGLIMLLGFYSTNLYNLIIRRYLS

Amino Acids from 3' Exons

AAHFCFCSFIRTNLLFWAWWWAAGNRFNKQQEKPLYCKRKLVPLWAVSTRY,QHTSAFVPSSGRIYSFGLGGNGQLGTGSTSNRKSPFTVKGNWYPYNGQCLPDI,STLLLLFLHQDEFTLLGLVVMGSWEPVQQATGKAPLLKEIGTPIMGSVYQIL