McDonnell Genome Institute

Washington University

CircRNA

chr10|67966682|67992323|-|HERC4|ENST00000277817.10

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9936

25

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

9

Peptide

NDYINWVQQQAYGMNCGPPDDFR

Amino Acids from 5' Exons

VNEKMGQIIQYDKFYIHEVQELIDIRNDYINWVQQQAYGM,MRKWDRLYSMINFIYMKYKNTEMIISTGSNSRPME,KENGTDYTVILYTSTRIDRHKKLYQLGPTAGLWN

Amino Acids from 3' Exons

NCGPPDDFRCPNPTKQIWTVNEALIQKWLSYPSGRFPVEIA,TVGHQMTSDVPIRQSRSGQMKLFRNGAILLEGFLWRP,LWATRLQMSQSDKADLDSESSNSEMAELSFWKVSCGDSQ